PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen08g019010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 558aa    MW: 62603.5 Da    PI: 6.7302
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen08g019010.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-094795171854
                       HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       +F++  ++yp+ +e++ LA k gLt +qV++WF N R +
  Sopen08g019010.1 479 MFQNflHPYPKDAEKQLLAVKSGLTRSQVSNWFINARVR 517
                       5887779******************************88 PP

2BELL71.81.2e-23353419471
              BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                       + ++kk  L+ ll+ Vd++Y+q+ +++++vis+F+av++l++  +++++Al++iS  +++L+++i++ 
  Sopen08g019010.1 353 DCEAKKKNLVALLQVVDDQYNQCLDEIHMVISAFHAVTELDP-SIHARFALQTISSLYKNLRERISNY 419
                       7899**************************************.9*********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.8E-22281418IPR006563POX domain
PfamPF075261.9E-27287417IPR006563POX domain
PROSITE profilePS5007111.224458521IPR001356Homeobox domain
CDDcd000869.93E-12461522No hitNo description
SMARTSM003895.5E-7461525IPR001356Homeobox domain
SuperFamilySSF466891.55E-15463530IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-26464527IPR009057Homeodomain-like
PfamPF059204.0E-15478517IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MAEPLRIIDE NFLHTTIVPI SFPETVCMDG QNQIMDGHGI PYPFMLQGEA LNTSHGFLNV  60
PNFPRPVDTE AIHNVLPVGR NRIKEYSVST SYPISNAYTD DQYMEGIPIS AVSLASLLAA  120
RNAMHENPEN LAVLAPLSHP TEGQKMDGLD YPNVLNHSFG SYRNYEFDGV SEIGGMVVGR  180
AGSQPFQLTE NVNSNTWFSS ETASLSSDSP SGSSRFSNEL CLSLTTSQSA VACGTTIRDQ  240
CSDISCSGVT NHAFPQRRFD SELTSCNSRN LSLSFGSYKP VHLSQFLTGS RYLRVMQEIL  300
SEIAQLSLQN HNLVGYRGNG TENGANTSFA LNSDAGRGYA AMSSDDSPDG LMDCEAKKKN  360
LVALLQVVDD QYNQCLDEIH MVISAFHAVT ELDPSIHARF ALQTISSLYK NLRERISNYI  420
LAMGEHFNKG GERGVEKSFE TSFIQKQWAL QQLKRKDHQL WRPQRGLPER SVSVLRAWMF  480
QNFLHPYPKD AEKQLLAVKS GLTRSQVSNW FINARVRLWK PMIEEMYAEM NRRKIRAGNK  540
DDHRRDHKII ESHLFTMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-15467524158Homeobox protein Meis1
4xrs_B3e-15467524158Homeobox protein Meis1
5bng_A3e-15467525159Homeobox protein Meis2
5bng_B3e-15467525159Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083171.10.0PREDICTED: homeobox protein ATH1
SwissprotP487311e-105ATH1_ARATH; Homeobox protein ATH1
TrEMBLK4CLC20.0K4CLC2_SOLLC; Uncharacterized protein
STRINGSolyc08g065420.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-106homeobox gene 1